MALTQQRKQEIINNYQVHGTDTGSTDVQIAMLTERINRLSEHLQANKKDHSSRRGLLKLIGHRKRLLAYLQQESREKYQALISRLGIRG RS15_ANAVT 89 One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate assembly of the platform of the 30S subunit by binding and bridging several RNA helices of the 16S rRNA (By similarity). Forms an intersubunit bridge (bridge B4) with the 23S rRNA of the 50S subunit in the ribosome (By similarity). rpsO 30S ribosomal protein S15 Ava_4651 rps15